Nesfatin-1 (mouse) trifluoroacetate salt,CAS:917528-36-0

Nesfatin-1 (mouse) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-992	50ug	350.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	917528-36-0
Sequence	VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms	Nucleobindin-2 (25-106) (mouse), NUCB2 (25-106) (mouse), DNA-Binding Protein NEFA (25-106) (mouse)
Molecular Formula	C₄₂₄H₆₈₃N₁₁₇O₁₃₇
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document